PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_A07050CB8.1
Common NameNFYB-A1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 81aa    MW: 9260.53 Da    PI: 6.2402
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_A07050CB8.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB123.21.1e-381781794
                  NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                           m+++lPa+akis+dake +qecvsefisfvt+ea+++c+ ++rkt+n++d++wal  lGf+dyv pl+v+l++ r+ e
  Traes_7DS_A07050CB8.1  1 MRRALPAHAKISDDAKEAIQECVSEFISFVTGEANERCRMQHRKTVNAEDIVWALNRLGFDDYVVPLSVFLHRMRDPE 78
                           89*************************************************************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.6E-19155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.74E-27178IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.3E-34178IPR009072Histone-fold
PRINTSPR006151.2E-141937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-143856No hitNo description
PRINTSPR006151.2E-145775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MRRALPAHAK ISDDAKEAIQ ECVSEFISFV TGEANERCRM QHRKTVNAED IVWALNRLGF  60
DDYVVPLSVF LHRMRDPEAG T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-301761893NF-YB
4awl_B6e-301761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-301761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090291e-126BT009029.1 Triticum aestivum clone wdk3c.pk023.h15:fis, full insert mRNA sequence.
GenBankKM0787341e-126KM078734.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966908.13e-40PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_006656887.17e-41PREDICTED: nuclear transcription factor Y subunit B-6-like
RefseqXP_008679062.16e-40PREDICTED: nuclear transcription factor Y subunit B-2-like
SwissprotQ84W662e-39NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0A7LWQ81e-55A0A0A7LWQ8_WHEAT; CCAAT-binding transcription factor A
TrEMBLW5I9I98e-56W5I9I9_WHEAT; Uncharacterized protein
STRINGOB06G20060.15e-40(Oryza brachyantha)
STRINGSi008357m1e-39(Setaria italica)
STRINGGRMZM2G124663_P012e-39(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.26e-41nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Qu B, et al.
    A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input.
    Plant Physiol., 2015. 167(2): p. 411-23
    [PMID:25489021]